PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000470422
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB_related
Protein Properties Length: 270aa    MW: 30234.3 Da    PI: 6.0259
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000470422genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-162971246
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +++T++E+e ++d++k  G++ W++Ia++++ gRt++++k++w++
    MDP0000470422 29 DNFTPQEEEHIIDLHKAIGSR-WSRIAKRLP-GRTDNDVKNYWNT 71
                     68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.588122IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.0E-11835IPR009057Homeodomain-like
SuperFamilySSF466892.88E-22882IPR009057Homeodomain-like
PROSITE profilePS5129422.8752377IPR017930Myb domain
SMARTSM007177.6E-142775IPR001005SANT/Myb domain
PfamPF002492.4E-143071IPR001005SANT/Myb domain
CDDcd001673.61E-113073No hitNo description
Gene3DG3DSA:1.10.10.605.1E-213674IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MSLSAGLNRC GKSCRLRWTN YLRPDLKHDN FTPQEEEHII DLHKAIGSRW SRIAKRLPGR  60
TDNDVKNYWN TKLKKKLSKM GIDPVTHKPY SQILSDYGNI SGLPSTDGNH PFSSLFKQSK  120
SAFAPELNSS CITGIPYTNV TXNPNINGQG FSQPTNACWE SHEAQITPSS SSFNWREYLL  180
YDPFTSADHL KQEQDLHGVM MSSPENPTFG VQGSSDAIEG CDFVGQRSYD WPDHQASSTS  240
MCSFVETILD QDSEMQAAFP QLLDASFDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-2097740108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340397.10.0PREDICTED: transcription repressor MYB6-like, partial
SwissprotQ9LSI77e-56MYB35_ARATH; Transcription factor MYB35
TrEMBLM5XBU21e-109M5XBU2_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g02180.t011e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-57MYB family protein